KEGG   Thermococcus piezophilus: A7C91_01415
Entry
A7C91_01415       CDS       T04941                                 
Name
(GenBank) two-component system response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
tpie  Thermococcus piezophilus
Pathway
tpie02020  Two-component system
tpie02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tpie00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7C91_01415
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    A7C91_01415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tpie02022]
    A7C91_01415
   02035 Bacterial motility proteins [BR:tpie02035]
    A7C91_01415
Two-component system [BR:tpie02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   A7C91_01415
Bacterial motility proteins [BR:tpie02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    A7C91_01415
SSDB
Motif
Pfam: Response_reg B12-binding
Other DBs
NCBI-ProteinID: ANF21998
UniProt: A0A172WF04
LinkDB
Position
259630..259992
AA seq 120 aa
MARVLVVDDAAFMRMLLKKILTQGGHQVVGEAANGKEAVQKYQELKPDIVTMDIVMPEMD
GITAVKEIKKVDPNAKIIMITAVGQEGKVMEALKAGASGYIVKPFQAPKVLEEINRVLSG
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcacgggttttggtcgtagatgatgcagcatttatgcgcatgctgctgaagaagata
ctaacccagggaggccaccaggtcgttggagaagctgcaaacggaaaggaggctgttcag
aagtaccaagaactcaagcccgacattgtaactatggacatagttatgcccgaaatggat
gggattaccgctgtgaaggagataaaaaaggtcgatccaaatgccaagataatcatgatt
accgccgttggacaagagggaaaggttatggaagcgttaaaagcaggagcctctggttac
atcgtcaagccgttccaagcccctaaggtgctggaagagataaatcgtgtgctgtcaggc
taa

DBGET integrated database retrieval system