Tautonia plasticadhaerens: ElP_05060 Help Entry ElP_05060         CDS       T09913                                  Symbol groS_1 Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism tpla  Tautonia plasticadhaerens Brite KEGG Orthology (KO) [BR:tpla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tpla03110]     ElP_05060 (groS_1)    03029 Mitochondrial biogenesis [BR:tpla03029]     ElP_05060 (groS_1) Chaperones and folding catalysts [BR:tpla03110]  Heat shock proteins   HSP10    ElP_05060 (groS_1) Mitochondrial biogenesis [BR:tpla03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     ElP_05060 (groS_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  QDV32671 UniProt:  A0A518GVU4 LinkDB All DBs Position 672117..672410 Genome browser AA seq 97 aa AA seqDB search MNIQPLGNRVVVDREEAQATTAGGIVLPDTAKDKPQKGKVVAVGDGTTSKDGTKKPLTVK VGDTVIFTSYAGDEFKLDGDQKVLLMREDDILAVVEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaacatccagccgctgggcaatcgcgtggtggtcgatcgggaagaggcccaggcgacg accgccggcggcatcgtgctgccggacacggccaaggacaagccgcagaagggcaaggtc gtcgccgtcggcgacggcaccacctccaaggacggcaccaagaagccgctgaccgtcaag gtcggcgacacggtcatcttcaccagctacgccggcgacgagttcaagctcgacggcgac cagaaggtcctcctgatgcgcgaggatgacatcctcgccgtcgtcgagggctga

DBGET integrated database retrieval system