Tautonia plasticadhaerens: ElP_22520 Help Entry ElP_22520         CDS       T09913                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism tpla  Tautonia plasticadhaerens Pathway tpla01100   Metabolic pathways tpla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ElP_22520    00074 Mycolic acid biosynthesis     ElP_22520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ElP_22520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDV34367 UniProt:  A0A518H0L8 LinkDB All DBs Position complement(2821305..2821577) Genome browser AA seq 90 aa AA seqDB search MSESEILDDLAGVLADFGGRDYSGPIGAETRFFADLGLASIDAVVLGESLQDFYGRPLPF GDLMAELGSRKDRDLTMGTLAKFLARHLGN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgaatccgagattctcgacgacctggccggggtcctggccgacttcggcggtcgg gattactccgggccgatcggcgcggagacccggttcttcgccgacctgggcctggcgtcg atcgacgcggtggtgctgggggagtcgctccaggacttctacggccgccccctgcccttc ggcgacttgatggcggagctggggtcccggaaggaccgcgacctgacgatggggacgctg gcgaagttcctggcccgacacctcgggaattga

DBGET integrated database retrieval system