Thalassoglobus polymorphus: Mal48_48780 Help Entry Mal48_48780       CDS       T09805                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism tpol  Thalassoglobus polymorphus Pathway tpol01100   Metabolic pathways tpol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mal48_48780 (acpP_3)    00074 Mycolic acid biosynthesis     Mal48_48780 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mal48_48780 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDT35600 UniProt:  A0A517QVF0 LinkDB All DBs Position complement(6291575..6291832) Genome browser AA seq 85 aa AA seqDB search MTPPEIRQVIINILERIAPDEDLSDLDDSVAFREQMELDSMDFLDIVMELRKLYRVQIPE SDYEQLASMNSTVEYLTPILKDTEV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactcccccggaaatacgtcaagtcattatcaatatcctggaacgcattgcccccgat gaagatttgtccgatctggacgactctgtcgcgtttcgagagcaaatggaactcgacagc atggacttcctcgacattgtcatggaacttcgcaagctgtaccgcgtgcaaattcctgaa tccgactacgaacagctggcttcaatgaatagcaccgtggaatacctcacgccgatcctc aaagatacggaagtgtaa

DBGET integrated database retrieval system