Treponema pallidum subsp. pallidum SS14: TPASS_0251 Help Entry TPASS_0251        CDS       T00716                                  Name (GenBank) DNA-binding protein II   KO K04764   integration host factor subunit alpha Organism tpp  Treponema pallidum subsp. pallidum SS14 Brite KEGG Orthology (KO) [BR:tpp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tpp03032]     TPASS_0251    03036 Chromosome and associated proteins [BR:tpp03036]     TPASS_0251    03400 DNA repair and recombination proteins [BR:tpp03400]     TPASS_0251 DNA replication proteins [BR:tpp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     TPASS_0251 Chromosome and associated proteins [BR:tpp03036]  Prokaryotic type   Nucleoid associated proteins    IHF (integration host factor)     TPASS_0251 DNA repair and recombination proteins [BR:tpp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       TPASS_0251 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 HTH_29 Motif Other DBs NCBI-ProteinID:  ACD70678 UniProt:  A0A0H3BHY7 LinkDB All DBs Position 264112..264429 Genome browser AA seq 105 aa AA seqDB search MKRVRRTRSFVVDALCDEVDLSRRHVARVVDSFVSVVTAALERGETVELRDFGVFESRVR KASVGKSIKTGEVVSIPSHCVVVFRPSKRLKSAVRGYRSGEVGAD NT seq 318 nt NT seq  +upstreamnt  +downstreamnt gtgaagagagttaggagaacgcggtctttcgttgtcgatgcactttgtgacgaggtggat ttgagccgtcgccatgtcgcgagggttgttgatagctttgtctctgtggtaaccgctgca ttggaacggggggagacagtcgagctgagggattttggggtgtttgagtctcgcgtgcgt aaggcttccgtcgggaagagcataaagacaggggaggtggtctctattccaagtcattgt gtggtagtgttccgccccagcaagcgtttaaagagtgcggtgcggggatatcgttcgggg gaggttggtgcggattga

DBGET integrated database retrieval system