Treponema pallidum subsp. pallidum SS14: TPASS_0589 Help Entry TPASS_0589        CDS       T00716                                  Symbol ptsH Name (GenBank) phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism tpp  Treponema pallidum subsp. pallidum SS14 Pathway tpp02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:tpp00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     TPASS_0589 (ptsH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tpp02000]     TPASS_0589 (ptsH) Transporters [BR:tpp02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     TPASS_0589 (ptsH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr TgMIC1 Motif Other DBs NCBI-ProteinID:  ACD71009 UniProt:  A0A0H3BJH9 LinkDB All DBs Position complement(642155..642421) Genome browser AA seq 88 aa AA seqDB search MVVKTVRVLNRAGVHARPAALIVQAASRFDSKIMLVRDTIRVNAKSIMGVMAMAAGCGSE LELVVEGPDEVAALSAIERLFQNKFEEE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggtcgtaaaaacggtgcgcgtgcttaatcgtgcgggcgtacatgcgcgtcctgcggcg cttattgtgcaagcggcaagtcgctttgattcgaagataatgcttgtgcgggatacgatc agagtgaatgcaaagtctattatgggtgttatggctatggctgcagggtgtggaagtgag ctcgagttggttgtagaaggtccagacgaagttgctgcattgtccgccattgagcggcta tttcagaataaattcgaggaagagtaa

DBGET integrated database retrieval system