Treponema pallidum subsp. pallidum SS14: TPASS_0974 Help Entry TPASS_0974        CDS       T00716                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism tpp  Treponema pallidum subsp. pallidum SS14 Pathway tpp02020   Two-component system tpp02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:tpp00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     TPASS_0974  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     TPASS_0974  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:tpp02035]     TPASS_0974 Bacterial motility proteins [BR:tpp02035]  Flagellar system   Flagellar assembly proteins    Others     TPASS_0974 SSDB OrthologParalogGFIT Motif Pfam:  FlgM Val_tRNA-synt_C HVO_2525_N Motif Other DBs NCBI-ProteinID:  ACD71390 UniProt:  A0A0H3BKG1 LinkDB All DBs Position complement(1059495..1059776) Genome browser AA seq 93 aa AA seqDB search MMIDKLSGLDPVQNLRASCASEHVARAPAGDEITVSAEAQKKAELYLALEAVRSAPDVRE YKIAAAEQKLADPAYLERALSHVVERFLEEQNL NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtgatgatcgataagctaagtggacttgatccggttcagaaccttcgcgcctcttgtgcg tctgagcatgtggcgcgtgctccagccggcgatgagattactgtctctgcggaagcccag aaaaaggctgagttgtacttggccctggaggcggtacgttctgcgcctgatgtgcgtgaa tacaaaatagcagctgcggagcagaagcttgcagaccctgcgtatctggagcgggcgctg tcccacgtggtggagcgcttcctggaggagcagaatttataa

DBGET integrated database retrieval system