KEGG   Candidatus Tremblaya princeps PCVAL: TCP_026
Entry
TCP_026           CDS       T01858                                 
Symbol
ilvI
Name
(GenBank) Acetolactate synthase III large (catalitic) subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
tpq  Candidatus Tremblaya princeps PCVAL
Pathway
tpq00290  Valine, leucine and isoleucine biosynthesis
tpq00660  C5-Branched dibasic acid metabolism
tpq00770  Pantothenate and CoA biosynthesis
tpq01100  Metabolic pathways
tpq01110  Biosynthesis of secondary metabolites
tpq01210  2-Oxocarboxylic acid metabolism
tpq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TCP_026 (ilvI)
   00660 C5-Branched dibasic acid metabolism
    TCP_026 (ilvI)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    TCP_026 (ilvI)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TCP_026 (ilvI)
Enzymes [BR:tpq01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     TCP_026 (ilvI)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-ProteinID: AEK38400
LinkDB
Position
22092..23789
AA seq 565 aa
MLHASGALVLIWTLSRIAILRLWGYPGGSVLGLYDEIYRCGLLRHLPVRCEQAAAHAACS
SYAATRALGACIVTSGPGITNAITGIATAQADSVPVLAISGQVPLASMGRGSFQECDAVG
LASPCTKGCYSLRRVLDIRRAAWEASLVAVTNRPSPVLLDFPKDVARRTLPCATEGGLRH
RPNHTAPQDVWSEPCGYILAHRAARYISTAARPLAYVGGGSAHSALRLAHIAGAACIPVA
GSLMGLDATPTRGSVGMVGMYGRLSANLAMQYSDLVVAMGARFDDRVVTSPARLAWRGRA
VVSVNVASSLTRDVGVSHMAMANVENFLGTLCRLLSSRGALNGSSVRPWTILLRSWRIHQ
RHGRLGFVLYGNMFRRAVIGACAVCCDVGQHQMWAAQYHTAGLTARRINSGGLGTMGCGI
PFAMSLQTLSHGLYSVCVTGDGSLQMSHHELPTLRSMGSRVMVVVLNNGSLGMVRQWQQV
EHCGRYSQSRSARYACASSMAEQHGHVGVDVLGPAHAFAAFADSRSSVRHTALLNVRHSS
HECVWPMVQGGRSITNMMTSYRDIN
NT seq 1698 nt   +upstreamnt  +downstreamnt
gtgcttcatgctagcggtgcgcttgtactaatatggactctgagtcgtattgccatactc
cggttgtggggctatccgggtggctcagtgctggggttgtacgacgagatatacaggtgt
ggccttttgaggcacctgcccgtaagatgcgagcaggctgcagctcatgccgcatgttcc
tcctatgccgcaacgcgcgcgctaggcgcgtgcatcgtcacatccggccccggaataacc
aacgccataactggcatagcaacggcgcaagcagactcggtgcctgtgctggcaataagc
gggcaggtgccattggcaagcatggggaggggttcatttcaggaatgcgatgctgtaggg
ctcgcatcgccgtgcaccaagggctgctatagcctgcgcagggtgcttgacataaggagg
gcggcatgggaggcaagccttgttgccgtaactaacagaccctccccagtcctccttgac
ttcccgaaggacgtggcaaggcgaaccctgccatgcgctactgaaggagggctgcggcat
aggcccaaccacactgcaccacaggatgtgtggtccgaaccttgcgggtacatccttgcc
catagggcggcaaggtatatatccactgctgcaagaccgctggcttatgtaggtgggggc
tctgcgcacagcgcgctgaggctggcacatattgctggggctgcctgcattccagttgca
ggtagtctgatgggactcgatgccacacctactcggggctcagtaggcatggtaggaatg
tatggccgtctgagtgcaaaccttgcgatgcagtacagcgacctggtggtggcaatgggg
gcccggtttgatgacagggtcgtcaccagcccggcacggcttgcatggcgcggcagggct
gtagtatctgtgaacgtagcgagctcactgactcgggacgtaggcgtgtcacacatggca
atggctaatgtagagaactttctaggcacgctgtgccggttactctcttcccgcggcgcg
cttaatggatcgtcagttcgcccatggacaatcttactccggagctggcgtatacaccag
aggcatggccgacttggattcgtcctgtatggcaacatgttcaggcgcgcagtgatcggc
gcttgcgccgtttgctgcgacgtggggcagcatcaaatgtgggccgcgcagtaccacact
gcgggcctcacggcacgtaggataaactcaggcggcctcggcaccatgggatgtggcata
ccattcgcaatgagcttacagaccctgtcgcatggtctgtactccgtgtgcgttacaggt
gatgggtccttgcaaatgagccatcacgagctcccaaccctgcgctccatggggtcaagg
gtcatggtcgtcgtgctaaacaacggcagcctgggcatggtgaggcaatggcagcaagta
gagcactgcggcaggtattcgcagtctaggtcagcaaggtacgcctgcgcctcttccatg
gcagagcagcatggtcatgtgggggtggatgtgctaggccctgcccatgccttcgccgcc
tttgctgattctaggagcagcgtacggcacacggcgcttctgaacgtgcggcacagtagc
catgagtgcgtttggccaatggtgcaaggtggtaggagcattactaatatgatgaccagc
tatagggatatcaactag

DBGET integrated database retrieval system