Trifolium pratense (red clover): 123883095 Help Entry 123883095         CDS       T08949                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism tpra  Trifolium pratense (red clover) Pathway tpra04136   Autophagy - other Brite KEGG Orthology (KO) [BR:tpra00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     123883095  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tpra04131]     123883095    04121 Ubiquitin system [BR:tpra04121]     123883095    03029 Mitochondrial biogenesis [BR:tpra03029]     123883095 Membrane trafficking [BR:tpra04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     123883095 Ubiquitin system [BR:tpra04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    123883095 Mitochondrial biogenesis [BR:tpra03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     123883095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  123883095 NCBI-ProteinID:  XP_045787745 LinkDB All DBs Position LG5:complement(43630540..43634916) Genome browser AA seq 94 aa AA seqDB search MAADSPTSVRKVVVHLRATGDAPILKQSKFKIAGTDKFAKVIEFLRRQLHRETLFVYVNS AFSPNPDELVVDLYNNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgctgattctccgacttctgttcgtaaagtggttgttcatctcagagccaccggt gatgctcctattcttaaacaatccaaattcaagatagcaggaactgataaatttgcaaaa gtgatagagtttcttcgcagacagctacacagggagacattgtttgtttatgtcaacagt gctttttcaccgaaccctgatgaactggtcgttgacttgtataataattttggttttgac ggaaaactggttgtgaactacgcttgttctatggcatggggctaa

DBGET integrated database retrieval system