Trifolium pratense (red clover): 123884049 Help Entry 123884049         CDS       T08949                                  Name (RefSeq) polyubiquitin isoform X1   KO K03873   elongin-B Organism tpra  Trifolium pratense (red clover) Pathway tpra04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tpra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     123884049  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tpra04121]     123884049    03400 DNA repair and recombination proteins [BR:tpra03400]     123884049 Ubiquitin system [BR:tpra04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      123884049    Cul5 complex      123884049 DNA repair and recombination proteins [BR:tpra03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      123884049 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD UBL_UBAC1 FlaG DNA_pol3_delta Dsc3_N Ubiquitin_2 Chal_sti_synt_N Motif Other DBs NCBI-GeneID:  123884049 NCBI-ProteinID:  XP_045789000 LinkDB All DBs Position LG5:19713775..19718745 Genome browser AA seq 103 aa AA seqDB search MDMYIRIKRDKTTYFIRCKPSDKILDIKEKLQELIDQPVNDQRLILPGTGEVLEDAKTLA DQKIETDAVVALTLRKDDNEFEEVNIVRPNDFYQTRDAEGGNW NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggatatgtacattcgcattaagcgtgataagacaacatatttcatccggtgtaagcca tctgacaaaattcttgacataaaggagaaattacaagaactaatcgatcaacctgttaat gaccaacggttaattctacctggtactggcgaagtattagaggacgctaagactctggct gatcaaaagattgaaactgatgctgttgttgcactgaccttgaggaaagatgataatgag tttgaggaagtcaacattgttcgaccaaatgatttctatcagacaagggatgcagagggt ggcaattggtaa

DBGET integrated database retrieval system