Trifolium pratense (red clover): 123896397 Help Entry 123896397         CDS       T08949                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism tpra  Trifolium pratense (red clover) Pathway tpra03083   Polycomb repressive complex tpra04120   Ubiquitin mediated proteolysis tpra04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tpra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123896397    04120 Ubiquitin mediated proteolysis     123896397   09126 Chromosome    03083 Polycomb repressive complex     123896397  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tpra04131]     123896397    04121 Ubiquitin system [BR:tpra04121]     123896397    03036 Chromosome and associated proteins [BR:tpra03036]     123896397 Membrane trafficking [BR:tpra04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     123896397 Ubiquitin system [BR:tpra04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      123896397    Cul7 complex      123896397 Chromosome and associated proteins [BR:tpra03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      123896397   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      123896397 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DUF620 Bestrophin Peptidase_C92 QTMAN_N Motif Other DBs NCBI-GeneID:  123896397 NCBI-ProteinID:  XP_045802745 LinkDB All DBs Position LG7:39057410..39057874 Genome browser AA seq 154 aa AA seqDB search MAEEKSQASSSKMLTLKASDGVLFEVELNIAKEMKTVQAYIDDCEDIETIPIPNVLGKHL AIVIEYIKKTNEEYDAEFEKQWNMDDLQLLLLAANYLNISGLQECLCKAIAKRIENKSPE YVRKVFNIENDHSPEEEAKLRKEYKWAFEGVDKD NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcagaagaaaaatcacaagcatcatcatcaaagatgctcacgctgaaagcatctgat ggtgttcttttcgaggttgaacttaacatcgcaaaagagatgaaaactgtgcaagcatac attgatgactgcgaagatattgaaacaattcctatacctaacgtattgggcaagcatctt gctatagtaatcgagtacatcaagaaaaccaacgaagaatatgatgccgaattcgagaag caatggaatatggatgacttgcagttactactccttgctgcaaattatctcaatataagc ggtcttcaggaatgtctatgcaaggccattgccaaacggattgagaataagagcccggag tatgtgcgcaaggtttttaatatcgaaaacgatcattcgcctgaggaagaagccaagctc cgcaaggaatataagtgggcttttgagggtgttgataaagattaa

DBGET integrated database retrieval system