Trifolium pratense (red clover): 123905379 Help Entry 123905379         CDS       T08949                                  Name (RefSeq) sm-like protein LSM4   KO K12623   U6 snRNA-associated Sm-like protein LSm4 Organism tpra  Trifolium pratense (red clover) Pathway tpra03018   RNA degradation tpra03040   Spliceosome Brite KEGG Orthology (KO) [BR:tpra00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     123905379   09123 Folding, sorting and degradation    03018 RNA degradation     123905379  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tpra03019]     123905379    03041 Spliceosome [BR:tpra03041]     123905379 Messenger RNA biogenesis [BR:tpra03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      123905379   mRNA degradation factors    5'-3' decay     Lsm complex      123905379 Spliceosome [BR:tpra03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     123905379 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  123905379 NCBI-ProteinID:  XP_045810938 LinkDB All DBs Position LG2:72347386..72349893 Genome browser AA seq 113 aa AA seqDB search MTVSSLEILPLSLLKSARGQPISVELTNGETYNGDLVDSNALMNIHLRGVICTSKDGDRL WCMPECYIYGNTIMCLRIPNEGKNATDVEQEVGENQGQHIKKRGHDFRNLSYD NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgacagtgtcatctttggaaattctgccactttctcttctcaagagtgctcgaggacaa ccaatttcagtagaattgacaaatggagagacatataatggggatttggttgattccaat gcactgatgaacattcatcttagaggagtcatttgtacttctaaggatggagatagactt tggtgtatgcccgaatgctatatttatgggaatactattatgtgtcttcgaattcctaat gagggaaagaatgcaactgatgtggagcaagaagtgggagagaatcagggccagcacatc aaaaaacgtggccatgatttcaggaatctcagttatgactga

DBGET integrated database retrieval system