Trichogramma pretiosum: 106658279 Help Entry 106658279         CDS       T07644                                  Name (RefSeq) UPF0691 protein C9orf116 homolog   KO K28113   piercer of microtubule wall 1 protein Organism tpre  Trichogramma pretiosum Brite KEGG Orthology (KO) [BR:tpre00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tpre03037]     106658279 Cilium and associated proteins [BR:tpre03037]  Motile cilia and associated proteins   Other motile cilia associated proteins    106658279 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PIRC1_2 Motif Other DBs NCBI-GeneID:  106658279 NCBI-ProteinID:  XP_014235655 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MKIECTDLTGPRTDELYRTVNIPLRFMYPKLLRGYRQSTMDPSSGDPHPCYRSTSMDYGW FAPTVHTVPTAYFPRNYAFSVEVARGGMWRNCSLNTELDKN NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagatcgaatgtacagaccttaccggaccgagaacagacgagctttatcgaaccgtc aatatacctttgcgattcatgtatccaaagctgctgaggggctacaggcagtcgacgatg gacccctcgagcggcgatccacatccatgctatcgcagcacgtcgatggattacggttgg ttcgcgccgaccgtgcacaccgtgccgaccgcctatttcccgcgaaactacgcgttcagc gtcgaggtggccaggggcggcatgtggcgcaattgctcgctcaatactgaactggataaa aactga

DBGET integrated database retrieval system