Trichogramma pretiosum: 106659081 Help Entry 106659081         CDS       T07644                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tpre  Trichogramma pretiosum Pathway tpre04013   MAPK signaling pathway - fly tpre04145   Phagosome tpre04148   Efferocytosis tpre04310   Wnt signaling pathway tpre04620   Toll-like receptor signaling pathway tpre05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tpre00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     106659081    04310 Wnt signaling pathway     106659081  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106659081    04148 Efferocytosis     106659081  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106659081  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     106659081  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tpre04131]     106659081   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tpre04147]     106659081    04031 GTP-binding proteins [BR:tpre04031]     106659081 Membrane trafficking [BR:tpre04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     106659081  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     106659081   Macropinocytosis    Ras GTPases     106659081  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     106659081 Exosome [BR:tpre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106659081   Exosomal proteins of other body fluids (saliva and urine)    106659081   Exosomal proteins of colorectal cancer cells    106659081   Exosomal proteins of bladder cancer cells    106659081 GTP-binding proteins [BR:tpre04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     106659081 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  106659081 NCBI-ProteinID:  XP_014236876 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLTMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRKCCLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaaatgcgttgttgtgggtgacggtgccgtgggtaaaacttgtttactc atcagttacactactaatgcatttcccggggaatacatacctactgtgtttgacaactat tctgccaatgttatggttgatggaaagccaatcaacttaggtctttgggacacagctggt caagaagattatgatagattaagacctttgtcttatccacaaactgatgtatttctcatt tgcttttcattggtaaatccagccagttttgaaaatgtcagagctaagtggtatccagaa gtacgtcaccattgtccagcaactcctattatactggttggaacaaaacttgatttgcgt gaagataaagaaactattgaacggctgaaagataaaaaacttgctcctataacttatcct cagggattaactatggctaaagaaatcggcgctgtcaagtacctcgagtgttctgcttta acgcaaaagggactgaaaacggtatttgatgaggcgattcgtgccgtcctctgtcccgtt ctacaggtgaaaccgaagcgcaagtgttgtctcctataa

DBGET integrated database retrieval system