Trichogramma pretiosum: 106659565 Help Entry 106659565         CDS       T07644                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism tpre  Trichogramma pretiosum Pathway tpre04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tpre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     106659565  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tpre04121]     106659565    03400 DNA repair and recombination proteins [BR:tpre03400]     106659565 Ubiquitin system [BR:tpre04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      106659565    Cul5 complex      106659565 DNA repair and recombination proteins [BR:tpre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      106659565 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Lin1244_N Motif Other DBs NCBI-GeneID:  106659565 NCBI-ProteinID:  XP_014237650 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MDVFLMIRRKKMTIFTDAKENTTVLELKKIIEGILKIPPVNQQLFNKETILMAESKLLSD YGLSSTTAKAQCPAVIGLAVRQENGQFEPLEMTPFSLPPDLPEVMKTQETNGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtttttttaatgattcggcggaaaaaaatgacaattttcactgatgcgaaggag aacacaacggttttggagctgaagaaaattatcgaaggaatactgaagattcctccagta aaccagcaactgtttaacaaagaaacaattttgatggctgagagcaaattattatcagac tatggactatcctctacaactgccaaagctcaatgtccggctgtgataggtttagcagtg cgtcaagaaaatggtcaattcgaaccattagaaatgactccattttcgctgccacccgat ctaccagaagttatgaaaacacaagaaaccaatggtcaagaacagtcaccttga

DBGET integrated database retrieval system