KEGG   Trichogramma pretiosum: 111693284
Entry
111693284         CDS       T07644                                 
Name
(RefSeq) S-phase kinase-associated protein 1-like
  KO
K03094  S-phase kinase-associated protein 1
Organism
tpre  Trichogramma pretiosum
Pathway
tpre03083  Polycomb repressive complex
tpre04120  Ubiquitin mediated proteolysis
tpre04141  Protein processing in endoplasmic reticulum
tpre04310  Wnt signaling pathway
tpre04341  Hedgehog signaling pathway - fly
tpre04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:tpre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111693284
   04120 Ubiquitin mediated proteolysis
    111693284
  09126 Chromosome
   03083 Polycomb repressive complex
    111693284
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111693284
   04341 Hedgehog signaling pathway - fly
    111693284
   04350 TGF-beta signaling pathway
    111693284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tpre04131]
    111693284
   04121 Ubiquitin system [BR:tpre04121]
    111693284
   03036 Chromosome and associated proteins [BR:tpre03036]
    111693284
Membrane trafficking [BR:tpre04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    111693284
Ubiquitin system [BR:tpre04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     111693284
   Cul7 complex
     111693284
Chromosome and associated proteins [BR:tpre03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     111693284
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     111693284
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 111693284
NCBI-ProteinID: XP_023313407
LinkDB
Position
Unknown
AA seq 150 aa
MASNQENSSKGPILHLQSSDEVVFDVELAIAKRSIMIKTLVESLGEDNLDEVLSLPYLKS
DILGKVIEFATHHKNDPMPNEYGKNEKTRMTEWDQTFLEVDLDTLFKLTLAANYLDMKDL
LDLVTQAISRHYAAKSVDELKKTKEILMPK
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcttcaaatcaagaaaactctagcaaggggccaatcctgcatttgcaaagttctgac
gaagtcgtttttgacgtggagttagcaatcgctaagcgctcaataatgataaaaacattg
gttgaaagtttaggcgaagataacttggatgaagttctttctctaccatatcttaagtct
gatattctgggaaaggttattgaattcgctactcatcataaaaatgatcccatgccaaac
gaatatggcaagaatgaaaaaactcgaatgacagaatgggatcaaacatttctagaggtt
gatttggacactctttttaaacttactttagcagccaattatttagatatgaaagatttg
ttagatttggtaacccaagcaataagccgacattatgcagcaaaatcagtagacgaactg
aaaaagactaaagaaatattgatgccaaagtag

DBGET integrated database retrieval system