Thermococcus profundus: A3L09_02580 Help Entry A3L09_02580       CDS       T05153                                  Name (GenBank) ribonuclease P   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism tprf  Thermococcus profundus Pathway tprf03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:tprf00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     A3L09_02580  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:tprf03009]     A3L09_02580    03016 Transfer RNA biogenesis [BR:tprf03016]     A3L09_02580    03029 Mitochondrial biogenesis [BR:tprf03029]     A3L09_02580 Enzymes [BR:tprf01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      A3L09_02580 Ribosome biogenesis [BR:tprf03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      A3L09_02580 Transfer RNA biogenesis [BR:tprf03016]  Eukaryotic type   5'processing factors    Ribonucrease P     A3L09_02580 Mitochondrial biogenesis [BR:tprf03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     A3L09_02580 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 Motif Other DBs NCBI-ProteinID:  ASJ02230 UniProt:  A0A2Z2M776 LinkDB All DBs Position 476908..477177 Genome browser AA seq 89 aa AA seqDB search MTARNIIWHELIGLKAKVIRASHPELVGIEGYVLDETRNTLTIGGDRVWTVPKDVVEFEF ETAAGERIRVDGRNLVGRPEMRLKKRWRK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgacggccagaaacataatatggcacgagctcatagggctgaaagcaaaggttataagg gcatctcatccagagctggttggcatcgagggctacgtccttgatgagacgcgtaacact ctcaccataggcggtgatagggtctggaccgttccgaaggacgtcgtcgagtttgagttc gagacggccgccggcgaaaggattagagtcgatgggagaaatctggtcgggagacccgag atgaggttgaagaagaggtggcgaaaatga

DBGET integrated database retrieval system