Thermococcus profundus: A3L09_03105 Help Entry A3L09_03105       CDS       T05153                                  Name (GenBank) histone   KO K24450   DNA-binding protein Organism tprf  Thermococcus profundus Brite KEGG Orthology (KO) [BR:tprf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tprf03036]     A3L09_03105 Chromosome and associated proteins [BR:tprf03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     A3L09_03105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C CENP-S TFIID-31kDa Bromo_TP TFIID-18kDa TFIID_20kDa PE DUF1931 LonB_AAA-LID EF-1_beta_acid PCP_red Motif Other DBs NCBI-ProteinID:  ASJ02315 UniProt:  A0A2Z2MCL3 LinkDB All DBs Position complement(559213..559416) Genome browser AA seq 67 aa AA seqDB search MAELPIAPIDRLIRKAGAERVSEEAAKVLAEHLEEYAIEVARKAAEFARHAGRKTVKAED IKLAIRT NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctgagttgccgattgctccaatcgacaggttgataaggaaggctggcgccgagagg gtcagcgaggaggccgccaaggttctcgccgagcaccttgaggagtacgctattgaggtc gccaggaaggccgctgagttcgccaggcacgctggcaggaagaccgtcaaggccgaggac atcaagctcgccatcaggacctga

DBGET integrated database retrieval system