Salipiger profundus: Ga0080559_TMP1855 Help Entry Ga0080559_TMP1855 CDS       T04656                                  Name (GenBank) Rod binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism tpro  Salipiger profundus Pathway tpro02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:tpro00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Ga0080559_TMP1855  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:tpro02035]     Ga0080559_TMP1855 Bacterial motility proteins [BR:tpro02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     Ga0080559_TMP1855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  APX22651 UniProt:  A0A1U7D3C4 LinkDB All DBs Position 1366019..1366279 Genome browser AA seq 86 aa AA seqDB search MKIAATPPPGHTSPLQKAAIQLEAAFLAELLKSAGVGESRDSFGGGIGEDQFASFLRQQH AGSLAQAGGIGLAESIFNALKERPDG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaagattgcagctactccaccgccgggccacacgagccccctgcagaaggcggcgatt caacttgaagcggccttcctcgcagaacttctcaaatccgccggcgttggagaaagccgg gacagtttcggtggcggtatcggtgaagatcaattcgcctcttttctgcgacagcaacac gccgggtcacttgcccaagccggcgggatcggacttgccgaatcgatcttcaacgcgctg aaggagcgccccgatggttga

DBGET integrated database retrieval system