KEGG   Salipiger profundus: Ga0080559_TMP3526
Entry
Ga0080559_TMP3526 CDS       T04656                                 
Name
(GenBank) two-component system, NtrC family, nitrogen regulation response regulator NtrX
  KO
K13599  two-component system, NtrC family, nitrogen regulation response regulator NtrX
Organism
tpro  Salipiger profundus
Pathway
tpro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ga0080559_TMP3526
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tpro02022]
    Ga0080559_TMP3526
Two-component system [BR:tpro02022]
 NtrC family
  NtrY-NtrX (nitrogen regulation)
   Ga0080559_TMP3526
SSDB
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 HTH_8 AAA_5 AAA_16 AAA cREC_REC AAA_19 FleQ AAA_2 MCM VpsR
Other DBs
NCBI-ProteinID: APX24322
UniProt: A0A1U7D889
LinkDB
Position
3113781..3115199
AA seq 472 aa
MSDILIVDDERDIRELIGDILEDEGYTTRLAANSTEAMSEVNAEPPGLLILDIWLKDSKM
DGIDILKTVKRDNPDIPIIIISGHGNIEIAVAAIKQGAYDFIEKPFNIDQLLVVIRRAME
TSRLRRENQQLKRRETEVAEMVGDSAAFRTLVSQLDKVTKSNGRVMLTGPAGSGKEVAAR
YIHGHSARASAPFVTVNCAGVAPETMEEVLFGRETPDRGIEPGLLEQAHGGVVYFDEVAD
MPLGTQSKILRVLVDQSFTRVGGSDKVRVDLRVISSTNRNLDHEIEAGRFRQELYHRLNV
VPIAVPSLEDRREDIPLLAAHFIDVCNKTQGLPLRALSDDAVALLQTMVWPGNVRQLKNL
VERVLILGEGTGPIEARELPQEAPAGDDEEGRVVLSGTLATLPLREAREAFEREYLLTQI
NRFGGNISRTAAFVGMERSALHRKLKSLGVVTGAKSGGRMAYVEDDPVQKVG
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgagcgacatcctcatcgtcgatgacgaacgcgacatccgcgagctgatcggggacatc
ctcgaggacgagggctacacgacccgcctcgcggccaattccaccgaggccatgtccgag
gtcaacgcggagcctccggggctgctcatcctcgacatctggctgaaggacagcaagatg
gacgggatcgacatcctcaagaccgtgaagcgcgacaatcccgacatcccgatcatcatc
atctcggggcacggcaacatcgagatcgcggtggccgccatcaagcagggcgcctacgat
ttcatcgagaagcccttcaacatcgaccagctgctggtggtgatccgccgcgcgatggag
acctcgcggctgcggcgcgagaaccagcagctgaagcgccgcgagaccgaagtggccgag
atggtcggcgacagcgccgcgttccgcacgctggtctcgcagctcgacaaggtgacgaag
tcgaacggccgggtgatgctcaccggccccgccggcagcggcaaggaagtggcggcgcgc
tacatccacgggcattcggcgcgggcctctgcgcccttcgtgacggtcaactgcgccggc
gtcgcccccgagacgatggaagaagtgctcttcggccgcgagacccccgaccgcggcatc
gagccgggcctgctcgagcaggctcacggcggcgtggtctacttcgacgaggtcgccgac
atgccgctcggcacccagtccaagatcctgcgggtgctggtcgaccagagcttcacccgc
gtcggcggctccgacaaggtccgcgtcgacctgcgggtgatttcctcgaccaaccgcaac
ctcgaccacgagatcgaggcaggccgcttccggcaggaactctaccaccgcctgaacgtg
gtgccgatcgcggtgccaagcctcgaggaccggcgcgaggacatcccgctgctcgccgcc
catttcatcgatgtctgcaacaagacccagggcctgccgctgcgcgcgctctccgatgac
gcggtggcgctgctgcagacgatggtctggcccggcaacgtgcgtcagctcaagaacctc
gttgaacgcgtgctgatcctcggcgagggcacgggcccgatcgaggcccgcgaactgccg
caggaggcgcccgccggcgatgacgaggaaggccgcgtggtgctctcgggcacgctggcg
accctgccgctgcgcgaggcgcgcgaggcgttcgagcgcgagtacctgctcacccagatc
aaccgcttcggcgggaatatctcgcgcaccgccgccttcgtcggcatggagcgctcggcg
cttcaccgcaagctcaagtcgctcggtgtcgtgaccggggccaagtccggtggccggatg
gcctatgtcgaagacgatccggtccagaaagtcggctga

DBGET integrated database retrieval system