Salipiger profundus: Ga0080559_TMP3980 Help Entry Ga0080559_TMP3980 CDS       T04656                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tpro  Salipiger profundus Pathway tpro01100   Metabolic pathways tpro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ga0080559_TMP3980    00074 Mycolic acid biosynthesis     Ga0080559_TMP3980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ga0080559_TMP3980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  APX24776 UniProt:  A0A1U7D9N2 LinkDB All DBs Position 3580277..3580537 Genome browser AA seq 86 aa AA seqDB search MSVKDRVIAIIAEQAMLEPSDVTMDSTLEDLGIDSLGLVESIFAIEEEFDISVPFNANEP GESDFDISSVATIVAGIEKLIAEQKT NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagtgtgaaggaccgggtcatcgcgatcatcgccgaacaggcgatgctggagccgtcg gacgtgacgatggacagcacgctggaggatctggggatcgacagcctcggccttgtcgag agcatcttcgccatcgaggaagagttcgacatctccgttccgttcaacgcgaacgagccg ggcgagagcgacttcgacatctcctcggtcgcgaccatcgtcgccggcattgaaaagctg atcgccgagcagaagacgtga

DBGET integrated database retrieval system