Salipiger profundus: Ga0080559_TMP4315 Help Entry Ga0080559_TMP4315 CDS       T04656                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tpro  Salipiger profundus Pathway tpro01100   Metabolic pathways tpro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ga0080559_TMP4315    00074 Mycolic acid biosynthesis     Ga0080559_TMP4315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ga0080559_TMP4315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  APX25111 UniProt:  A0A1U7DAC3 LinkDB All DBs Position complement(3938432..3938665) Genome browser AA seq 77 aa AA seqDB search MSDIPDRVRKIVVEHLGVEEDKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKEAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatccctgatcgcgtgcgcaagatcgttgtcgaacacctcggcgtcgaagaa gacaaggtgaccgagagcgcctcgttcatcgacgacctgggcgcggacagcctcgacacc gtcgagctggtcatggccttcgaggaagagttcggcatcgagatcccggacgacgcagcc gagaccatccagaccttcggcgacgcggtcaagttcatcaaggaagcccagtaa

DBGET integrated database retrieval system