Thalassiosira pseudonana: THAPSDRAFT_14971
Help
Entry
THAPSDRAFT_14971 CDS
T01078
Name
(RefSeq) predicted protein
KO
K06639
cell division cycle 14 [EC:
3.1.3.16
3.1.3.48
]
Organism
tps
Thalassiosira pseudonana
Brite
KEGG Orthology (KO) [BR:
tps00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:
tps01009
]
THAPSDRAFT_14971
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:
tps03037
]
THAPSDRAFT_14971
Enzymes [BR:
tps01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.3 Phosphoric-monoester hydrolases
3.1.3.16 protein-serine/threonine phosphatase
THAPSDRAFT_14971
3.1.3.48 protein-tyrosine-phosphatase
THAPSDRAFT_14971
Protein phosphatases and associated proteins [BR:
tps01009
]
Protein tyrosine phosphatases (PTPs)
Class I PTPs (Dual specificity phosphatases)
CDC14
THAPSDRAFT_14971
Cilium and associated proteins [BR:
tps03037
]
Other cilia and associated proteins
Stereociliary proteins
THAPSDRAFT_14971
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DSPn
Tc-R-P
DSPc
PTP-SAK
Y_phosphatase
PTPlike_phytase
PTP-NADK
Y_phosphatase3
Motif
Other DBs
NCBI-GeneID:
7449897
NCBI-ProteinID:
XP_002297024
JGI:
14971
UniProt:
B8LD57
LinkDB
All DBs
Position
19
Genome browser
AA seq
326 aa
AA seq
DB search
AVEIIPNRLYYAPLKFFPPEYNIHYFSIDTTLIYWNFFLDFGPLNLGQLYRFSSLLNHKL
SSPEYKDDIICYYSSGKGDARANASFLICAWSMLYLGRGLEESYFGFREELHPLPPFHDA
SPIVCTYDLSVYDCLRGLDKARKFGFFNRNPDTFNVEEYEYFEQVENGDLNWIIQNKILA
FAGPQNQKLITPEGFCMLTPADYIPYFLKKNVKLVVRLNKKCYEEREFENAGINHVEHYY
LDGSCPDMKILRAVLADMESIAPDEAMAIHCKAGLGRTGTCIGAYMMKHYRMTAREVIGW
MRICRPGMVIGPQQHFLEDIEQLMWQ
NT seq
978 nt
NT seq
+upstream
nt +downstream
nt
gcagttgaaatcattcccaaccgtttatactatgctcctttgaagttctttccgccagag
tacaatattcactacttctccatagacacaactctcatctactggaactttttcctcgac
tttggtcctctcaatctaggtcaactttaccgattctcctccctcttgaatcacaaattg
agttcgcccgagtacaaagatgacattatctgttattacagtagtgggaagggagatgct
agagccaatgcaagcttcttgatttgtgcttggagcatgttgtatttgggaagggggttg
gaggagagttattttggatttcgggaggaattgcatcctcttccgccttttcatgacgcc
tcgcccattgtatgcacgtacgatttgtctgtctacgattgtcttcgcggattggataag
gcacgtaagtttggcttcttcaatcgtaaccccgacaccttcaacgtggaagagtatgaa
tactttgaacaagttgaaaacggcgatctcaattggatcatacaaaacaaaatccttgct
tttgcgggtcctcagaatcaaaagctaatcacccctgagggattttgcatgctgactcct
gccgattacattccttacttcttgaagaagaatgtcaagttggtggtgaggttgaataag
aagtgttatgaagaacgtgaatttgagaacgcgggtattaatcacgtggagcactactat
ttggatggatcgtgtccagatatgaagatcttgcgagcagtgcttgcggatatggaatcc
attgctccggacgaagcaatggcgattcattgcaaggctggtttgggaaggacggggaca
tgcatcggagcttacatgatgaagcattatcgcatgacggcgagggaagtcattggatgg
atgaggatctgtcggccgggaatggtcattgggccgcagcagcacttcctggaagacatt
gagcagctcatgtggcag
DBGET
integrated database retrieval system