Thalassiosira pseudonana: THAPSDRAFT_261228 Help Entry THAPSDRAFT_261228 CDS       T01078                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism tps  Thalassiosira pseudonana Pathway tps04814   Motor proteins Brite KEGG Orthology (KO) [BR:tps00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     THAPSDRAFT_261228  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tps04131]     THAPSDRAFT_261228   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tps03037]     THAPSDRAFT_261228    04812 Cytoskeleton proteins [BR:tps04812]     THAPSDRAFT_261228 Membrane trafficking [BR:tps04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     THAPSDRAFT_261228 Cilium and associated proteins [BR:tps03037]  Motile cilia and associated proteins   Dynein arm    THAPSDRAFT_261228 Cytoskeleton proteins [BR:tps04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      THAPSDRAFT_261228 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Robl_LC7 LAMTOR5 Diacid_rec Motif Other DBs NCBI-GeneID:  7442224 NCBI-ProteinID:  XP_002287666 JGI:  261228 UniProt:  B8BTK1 LinkDB All DBs Position 2:complement(335951..336418) Genome browser AA seq 91 aa AA seqDB search MEEMISRIRSHKSVEGVMIMDRRGAIIQSTLDEEQTTTHANALSNLTAQASHIVGMLNQD DELTFLRIRSKQREIAISSDNGFLLVVLQNP NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggaagagatgatatctcgcattcgttcacacaagagtgtggagggtgttatgataatg gatcgtcgaggggcaatcattcagtcaacattggacgaagaacagacaaccactcatgca aacgctctctcaaatctaactgcacaggcgtctcacattgtaggcatgctgaatcaagac gatgagcttacctttcttcggatacgatcaaagcaacgagagattgcgatttcttcagac aatgggtttctgttggtagtgctgcagaatccc

DBGET integrated database retrieval system