Thalassiosira pseudonana: THAPS_20268 Help Entry THAPS_20268       CDS       T01078                                  Name (RefSeq) predicted protein   KO K12605   CCR4-NOT transcription complex subunit 2 Organism tps  Thalassiosira pseudonana Pathway tps03018   RNA degradation Brite KEGG Orthology (KO) [BR:tps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     THAPS_20268  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tps03019]     THAPS_20268 Messenger RNA biogenesis [BR:tps03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      THAPS_20268   mRNA degradation factors    3'-5' decay     Ccr4-NOT complex      THAPS_20268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NOT2_3_5_C Motif Other DBs NCBI-GeneID:  7444263 NCBI-ProteinID:  XP_002295562 JGI:  20268 UniProt:  B5YLR3 LinkDB All DBs Position 18:complement(342234..342461) Genome browser AA seq 76 aa AA seqDB search KFQLETLFYIFYALPKDVLQAYAAQELYTREWRYHVESKVWFKRATASDGIPNNNASAGQ FIYFDINTWERRMYGN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt aaatttcagctggaaactctcttctacatcttctatgctcttccaaaagacgtgttacaa gcgtacgcagctcaggagctgtacacgagggagtggaggtaccatgttgagtcaaaggtg tggttcaagcgggcaacggcatcggatggaattcctaacaacaatgcgtcggcgggtcag ttcatctactttgatatcaacacatgggaacgtcggatgtatggcaat

DBGET integrated database retrieval system