KEGG   Tunturiibacter psychrotolerans: RBB77_00440
Entry
RBB77_00440       CDS       T10213                                 
Symbol
kdpB
Name
(GenBank) potassium-transporting ATPase subunit KdpB
  KO
K01547  potassium-transporting ATPase ATP-binding subunit [EC:7.2.2.6]
Organism
tpsc  Tunturiibacter psychrotolerans
Pathway
tpsc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tpsc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RBB77_00440 (kdpB)
Enzymes [BR:tpsc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.6  P-type K+ transporter
     RBB77_00440 (kdpB)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase HAD Hydrolase_3 DUF759
Other DBs
NCBI-ProteinID: XCB33381
UniProt: A0AAU7ZR35
LinkDB
Position
complement(139423..141462)
AA seq 679 aa
MANTRKRSLWDTKIVRRALIDALVKLSPRTMMKNPVMFVVEIGSVITTIYLLRDTLSHRG
SFQFDLQITLWLWFTVLFANFAEAMAEGRGKAQADALRRAKSETTAVRLRTDGSTEEVPS
SHLRAGDQVLVVAGNMIPGDGEVIEGVASVDESAITGESAPVIREAGGDRSAVTGGTRVL
SDQIKVRITSNPGETFLDRMIALVEGAERQKTPNEIALNILLAGLTIIFLLAVVTLQPIA
IYSNAPQTVFVLISLLVCLIPTTIGGLLSAIGIAGMDRLVQHNVLAMSGRAVEAAGDVNT
LLLDKTGTITLGNRQAAEFIPAPGVSKDQLADAAQLSSLPDETPEGRSIVVLAKELYGLR
GRELSELQAEFVPFSAVTRMSGVNLDGRIIRKGSTDAIAAFLKENGGSLPDEVRAAVETV
ARSGGTPLVVAENRQALGVIHLKDIVKGGMKERFAQLRSMGIRTIMITGDNPLTAAAIAR
EAGVDDFLAEAKPKDKMDLIRREQAEGKLVAMTGDGTNDAPALAQADVGVAMNTGTQAAK
EAGNMVDLDSNPTKLIEIVEIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFAATFPVLN
ALNIMHLKTPESAILSAVIFNALIIVGLIPLALRGVGYKAMSAEALLQRNLFIYGVGGLV
APFLGIKIIDLIITAIHLA
NT seq 2040 nt   +upstreamnt  +downstreamnt
atggcaaatacccgcaaacgctccttatgggacaccaaaattgtacgtcgcgcgttgatt
gacgctctagtcaagctgagcccgcgcacgatgatgaagaacccggtcatgttcgtcgtt
gagatcggcagcgtgattactacgatctatctgcttcgcgatactttgtcgcatcgcggt
tcgtttcaattcgatttgcagattacgctgtggctttggtttacggtgctgttcgcaaac
tttgccgaggcgatggcggagggccgcggaaaggcccaggcagacgcgctacggcgtgca
aagtcggagacgaccgcagtgcggcttcgcacggatggaagcacggaggaggtccccagt
tcgcatctgcgagccggggatcaggttctcgttgttgccggtaatatgattcccggcgat
ggcgaagtgatagagggcgttgcttcggtggatgagtcggcgattacgggtgagtctgcg
ccggtaattcgggaggctggtggagaccggtcggcggtgacgggtggaacgcgggtgttg
tcggaccagatcaaggtgaggatcacgtcgaatcctggcgagacgttccttgatcgtatg
attgcgctggttgagggtgccgagcgacagaagacgccgaacgagatcgctctgaatatc
ctgcttgccgggttgacgatcatcttcctgcttgcagtcgtgacgcttcagcctattgcg
atctattccaatgcgccgcagacggtgtttgtgctgatctcgttgctggtgtgtctcatt
ccgacgacgatcggcggcttgctctcggcgattgggattgctgggatggatcgtctggtt
cagcacaatgtgctggcgatgtctgggcgagctgtggaagcagctggtgatgtaaacaca
cttctgttagacaagacgggaacgattacgctgggcaatcgtcaggctgctgagtttata
cctgcgcctggtgtgagcaaggatcagcttgcagatgcagcacagttgtcttcgcttccg
gatgagacaccggaaggacgaagcattgtggtcttggcgaaggaattgtatggtcttcgc
ggacgagagttgagcgagttgcaggcggagtttgtgccgttcagcgcggtgacgagaatg
tcgggcgtgaaccttgatgggcgaattattcggaagggttcgacggatgctatcgctgcg
tttttgaaagagaacggaggaagtttgccggatgaggttcgggcggcggttgagacggtt
gctcgcagcggggggacgccgctggtggtggctgagaatcggcaggcgctgggtgtgatc
cacctgaaggacattgtgaagggcgggatgaaggagcggtttgcgcagcttcggtcgatg
gggattcggacgatcatgattacgggggacaatcctctgactgcggcggctatcgcgcgc
gaggcaggagttgacgactttctggcagaggcgaagccgaaggacaagatggacctcatt
cgccgcgagcaggctgaaggcaaactggtcgcgatgacaggcgacggtacgaacgatgct
cctgcgcttgctcaggccgacgtgggtgttgcgatgaacaccggaacgcaggcggcgaag
gaggcgggaaatatggtcgatctcgactcgaacccgacgaagctgatcgagattgtggag
atcggcaagcagttgctgatgactcgtggcgcgctgactacgttctcgattgcgaacgac
gttgcgaaatactttgcgattattcccgcgatgtttgcggcgacgttcccggtgttgaat
gcgctgaacatcatgcacctgaagacaccggagtccgcaattctctctgcggtgatcttc
aatgctctgattattgtcggcttgattccgctggctctgcggggcgttggttataaggct
atgtcggcggaggcgttgttgcagcgcaatctgtttatctatggtgtcggtggccttgta
gctccttttctcgggatcaagattatcgacctcatcatcactgccattcacctggcgtaa

DBGET integrated database retrieval system