Tunturiibacter psychrotolerans: RBB77_02000 Help Entry RBB77_02000       CDS       T10213                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tpsc  Tunturiibacter psychrotolerans Pathway tpsc01100   Metabolic pathways tpsc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpsc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RBB77_02000    00074 Mycolic acid biosynthesis     RBB77_02000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RBB77_02000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  XCB33681 UniProt:  A0AAU7ZRW7 LinkDB All DBs Position 542439..542681 Genome browser AA seq 80 aa AA seqDB search MAAVDEKVKQIIVEQLQVDEAEVTPGASFQEDLGADSLDVVELVMQFEEAFDIQIPDEDA EKIKTVKDAVDYIEKNQKAK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtagacgagaaggtaaagcagattattgtcgaacagcttcaggtggatgaa gcggaagtcaccccgggcgcaagctttcaggaagatctcggcgcagactccctcgacgtc gtcgaactcgtcatgcagttcgaagaagccttcgacattcagatccccgacgaagatgcc gagaagatcaagaccgtcaaagatgctgtcgactacatcgaaaagaaccagaaggccaag taa

DBGET integrated database retrieval system