Tunturiibacter psychrotolerans: RBB77_20760 Help Entry RBB77_20760       CDS       T10213                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tpsc  Tunturiibacter psychrotolerans Pathway tpsc01100   Metabolic pathways tpsc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpsc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RBB77_20760    00074 Mycolic acid biosynthesis     RBB77_20760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RBB77_20760 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XCB32827 UniProt:  A0AAU7ZPE8 LinkDB All DBs Position 4984141..4984401 Genome browser AA seq 86 aa AA seqDB search MNDIATRCIDIIAKSKSIPADTISLASTFDELNIDSLDKINISFEVEEAFNIEIPDEALS TLRTVGDMVEGVTKLTATTPSTITTH NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgacatcgctacacgctgcatcgacatcatcgccaaatcaaagagcattcctgcg gacaccatctccctggccagcaccttcgacgagctcaacatcgactccctcgacaagatc aacatctccttcgaggtcgaagaagccttcaacatcgagatccccgacgaagccctcagc actctccgcaccgtaggcgacatggtcgaaggcgtaacaaagctcaccgccaccaccccc tccaccatcaccacccactag

DBGET integrated database retrieval system