Thermotoga petrophila RKU-1: Tpet_0675 Help Entry Tpet_0675         CDS       T00525                                  Name (GenBank) Fe-S cluster domain protein   KO K03616   H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] Organism tpt  Thermotoga petrophila RKU-1 Brite KEGG Orthology (KO) [BR:tpt00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Tpet_0675 Enzymes [BR:tpt01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)      Tpet_0675   7.2  Catalysing the translocation of inorganic cations    7.2.1  Linked to oxidoreductase reactions     7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)      Tpet_0675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FeS Motif Other DBs NCBI-ProteinID:  ABQ46695 UniProt:  A5IKH2 LinkDB All DBs Position complement(680551..680853) Genome browser AA seq 100 aa AA seqDB search MKELEVIYSTLLLAVLGFGFGAFLAYSAQKFKVEEDPRVKMITEVLPGINCGACGFAGCE AYAKAIVKGQAETNRCLPGRPQGVEEKIKKILEEYKNVSS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtgaaggagttggaagtcatctactcgacgctcttgctcgctgttctgggttttgggttc ggggcttttcttgcttattctgcgcagaaattcaaggtggaagaagatccacgtgtgaag atgataacggaggttcttcctggaataaactgtggcgcgtgcggttttgccgggtgtgaa gcctacgcgaaggcgatcgtgaagggtcaggcggaaacgaacaggtgtctccccggaaga cctcagggtgtcgaagagaagataaagaagattctcgaggagtacaagaatgtctcctct tga

DBGET integrated database retrieval system