Tatumella ptyseos: NCTC11468_01790 Help Entry NCTC11468_01790   CDS       T05493                                  Symbol rnfB_2 Name (GenBank) Nitrogen fixation protein rnfB   KO K03616   H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] Organism tpty  Tatumella ptyseos Brite KEGG Orthology (KO) [BR:tpty00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     NCTC11468_01790 (rnfB_2) Enzymes [BR:tpty01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)      NCTC11468_01790 (rnfB_2)   7.2  Catalysing the translocation of inorganic cations    7.2.1  Linked to oxidoreductase reactions     7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)      NCTC11468_01790 (rnfB_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FeS BPD_transp_2 Motif Other DBs NCBI-ProteinID:  SQK74755 UniProt:  A0A2X5R853 LinkDB All DBs Position 1:complement(1609072..1609338) Genome browser AA seq 88 aa AA seqDB search MSAIWIAVISLSILGLVFGALLGYASRRFKVEEDPIVEQIDELLPQSQCGQCGYPGCRPY ADAVGNHGEMINKCAPVESRPCSNWPRY NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagtgctatctggattgcggttatttcgctgagtatcttaggtctggtattcggcgct ctgctggggtacgcctcacgccgctttaaagtagaagaagacccgattgtcgaacagatc gacgaattactgccacaaagccagtgcggacagtgtggctatcccggctgccgcccttac gcggacgcggtaggtaatcacggtgagatgatcaacaagtgtgccccggtggagagcaga ccatgctcaaactggccacgttactga

DBGET integrated database retrieval system