Candidatus Thiothrix putei: QJT81_12920 Help Entry QJT81_12920       CDS       T10292                                  Symbol queF Name (GenBank) preQ(1) synthase   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism tput  Candidatus Thiothrix putei Pathway tput00790   Folate biosynthesis tput01100   Metabolic pathways Module tput_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:tput00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     QJT81_12920 (queF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:tput03016]     QJT81_12920 (queF) Enzymes [BR:tput01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      QJT81_12920 (queF) Transfer RNA biogenesis [BR:tput03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     QJT81_12920 (queF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  QueF QueF_N Motif Other DBs NCBI-ProteinID:  WGZ92748 UniProt:  A0AA95KMN1 LinkDB All DBs Position complement(2511342..2511731) Genome browser AA seq 129 aa AA seqDB search MSTRPSKDLETFPNPNPQRDYTIRIDMPEFTCICPKTGQPDFAQFKLEYVPDQKNVELKS LKLYMWSYREEGAFHEAVTNKILEDLVAATEPRFMRLTGVWNVRGGIYTTVVVEHHQAGW QPSPKVELP NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccacacgccccagcaaagaccttgaaactttccctaaccctaacccacagcgtgat tacacgatccgcattgatatgccggaattcacgtgtatatgcccaaaaacaggtcagccg gattttgcgcagttcaagcttgaatacgtgcctgaccagaaaaatgttgaactgaaatcc ctgaaattgtacatgtggagctaccgtgaagagggtgcattccacgaggctgtcaccaat aaaatcttagaggatctggtggctgcgactgagccacgttttatgcgcttaaccggggtg tggaatgtacgtggtggtatttacacaacggtagttgtcgagcatcaccaagcgggctgg cagccatcacccaaggtcgaactgccgtaa

DBGET integrated database retrieval system