Thermacetogenium phaeum: Tph_c04010 Help Entry Tph_c04010        CDS       T02276                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism tpz  Thermacetogenium phaeum Brite KEGG Orthology (KO) [BR:tpz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tpz03110]     Tph_c04010 (groS)    03029 Mitochondrial biogenesis [BR:tpz03029]     Tph_c04010 (groS) Chaperones and folding catalysts [BR:tpz03110]  Heat shock proteins   HSP10    Tph_c04010 (groS) Mitochondrial biogenesis [BR:tpz03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Tph_c04010 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Glyco_hydro_31_3rd Motif Other DBs NCBI-ProteinID:  AFV10648 UniProt:  K4LCY6 LinkDB All DBs Position complement(414020..414304) Genome browser AA seq 94 aa AA seqDB search MLKPLGDHVLVKPLSKEEKTEGGIYLPDTAKEKPQEGEVIAVGPGRLLENGTRVQPEVKV GDKVIYAKYGGTEIKLGDVEYLIMRESDILAIKD NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgctgaagccacttggtgaccacgtactggtgaaacctctctccaaagaggaaaaaacc gaaggaggcatctaccttcccgacaccgcgaaggaaaagcctcaggaaggagaagtaatc gcggtgggaccgggccggctcctggaaaacggcacccgcgtgcagcctgaggttaaggtc ggcgacaaggttatctacgccaagtacggcggaaccgaaatcaaactcggtgatgtcgag tacctgatcatgcgtgaaagcgacatcctggccatcaaagactag

DBGET integrated database retrieval system