Thermacetogenium phaeum: Tph_c28870 Help Entry Tph_c28870        CDS       T02276                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tpz  Thermacetogenium phaeum Pathway tpz00020   Citrate cycle (TCA cycle) tpz00720   Other carbon fixation pathways tpz01100   Metabolic pathways tpz01110   Biosynthesis of secondary metabolites tpz01120   Microbial metabolism in diverse environments tpz01200   Carbon metabolism tpz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tpz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Tph_c28870   09102 Energy metabolism    00720 Other carbon fixation pathways     Tph_c28870 Enzymes [BR:tpz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Tph_c28870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_8 Fer4_6 Fer4_17 Fer4_4 LdpA_Fe-S-bd Fer4_3 Fer4_22 Whib crAss_PVA Usp-48 Motif Other DBs NCBI-ProteinID:  AFV13052 UniProt:  K4LLS0 LinkDB All DBs Position complement(2905719..2905982) Genome browser AA seq 87 aa AA seqDB search MEKKKAITTEVNKGKAIFSLFPGLCKGCGLCREKCPEKALNWSEKLGVYGTPTVIPDPAL CKACRICEQVCPDCAIAIMRKDGDKDK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaaaagaagaaagcgatcaccaccgaggtcaataaagggaaggcgatcttctctctg tttcccgggctctgtaagggctgcggcctctgccgggaaaagtgcccggagaaagccttg aactggtcggagaagctgggggtttacgggactcccaccgtgattccggatcccgccctc tgcaaggcctgccggatctgtgagcaggtctgcccggactgcgccatcgccattatgcgc aaagatggggataaggataagtga

DBGET integrated database retrieval system