Truepera radiovictrix: Trad_2794 Help Entry Trad_2794         CDS       T01254                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tra  Truepera radiovictrix Pathway tra01100   Metabolic pathways tra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tra00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Trad_2794    00074 Mycolic acid biosynthesis     Trad_2794   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Trad_2794 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ADI15896 UniProt:  D7CV69 LinkDB All DBs Position 3039291..3039530 Genome browser AA seq 79 aa AA seqDB search MDRSEILAKIKEVAADKLDADPSDVTEEASFVDDLGADSLDVVELIMGLEDEFGIEISDE EAEKIRTVGDAVTFIAAQK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaccgcagtgaaatcctcgccaagatcaaagaagtcgccgccgacaaactcgacgcc gatccgagcgacgtcaccgaagaggcgtcgttcgtcgatgacctgggggccgactcgctc gacgtcgtcgagctgatcatggggctcgaggacgagttcggcatcgagatcagcgacgaa gaggctgaaaagatccgcaccgtcggcgacgccgtcacctttatcgcggcgcaaaagtag

DBGET integrated database retrieval system