Trichoderma reesei QM6a: TRIREDRAFT_119983 Help Entry TRIREDRAFT_119983 CDS       T02991                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism tre  Trichoderma reesei QM6a Pathway tre03050   Proteasome tre03440   Homologous recombination Brite KEGG Orthology (KO) [BR:tre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     TRIREDRAFT_119983   09124 Replication and repair    03440 Homologous recombination     TRIREDRAFT_119983  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tre03019]     TRIREDRAFT_119983    04131 Membrane trafficking [BR:tre04131]     TRIREDRAFT_119983    03051 Proteasome [BR:tre03051]     TRIREDRAFT_119983    03400 DNA repair and recombination proteins [BR:tre03400]     TRIREDRAFT_119983 Messenger RNA biogenesis [BR:tre03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      TRIREDRAFT_119983 Membrane trafficking [BR:tre04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     TRIREDRAFT_119983 Proteasome [BR:tre03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      TRIREDRAFT_119983 DNA repair and recombination proteins [BR:tre03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      TRIREDRAFT_119983 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  18482763 NCBI-ProteinID:  XP_006961933 JGI:  Trire2_119983 UniProt:  G0R835 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MASTTETKPTEPEQLNANEQKPEQKHLALGEDDEFEDFPIDDWPADQTEAAQRNGETKHL WEESWDDDDTSDDFSNQLKWVVGSLLVSTILLTALSLDFRPRRRFR NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcatcaaccacagaaaccaagccaaccgaacccgaacagctcaacgccaacgagcag aagcccgagcagaagcacctggccctcggcgaagacgacgaattcgaagactttcccatc gacgactggcccgccgaccaaaccgaggccgcccagcgcaacggcgagaccaagcatctg tgggaggagagctgggacgacgacgacacgagcgacgacttttcgaatcagctcaagtgg gtggttggctctctccttgtttctactattctcctcaccgcgctgtcgctcgactttcgc ccccgtcgccgctttcgttga

DBGET integrated database retrieval system