Trichoderma reesei QM6a: TRIREDRAFT_3007 Help Entry TRIREDRAFT_3007   CDS       T02991                                  Name (RefSeq) hypothetical protein   KO K27246   non-histone chromosomal protein 6 Organism tre  Trichoderma reesei QM6a Brite KEGG Orthology (KO) [BR:tre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tre03036]     TRIREDRAFT_3007 Chromosome and associated proteins [BR:tre03036]  Eukaryotic type   Nucleosome assembly factors    Histone chaperones     FACT complex      TRIREDRAFT_3007 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 Ccdc124 HMG_box_5 CHDNT Motif Other DBs NCBI-GeneID:  18484455 NCBI-ProteinID:  XP_006963060 JGI:  Trire2_3007 UniProt:  G0RDU2 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MQDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKLLGERWKALNDKQRAPYEAKA AADKKRYEDEKQAYNADQEEDSS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaagaccccaacgctcccaagcgcggtctctccgcctacatgttcttcgccaacgag cagcgtgagaacgtgcgtgaggagaaccccggcatctcattcggccaggtcggcaagctt ctcggcgagcggtggaaggccctcaacgacaagcagcgtgccccttatgaggccaaggct gccgccgacaagaagcgctacgaggatgagaagcaggcttacaacgccgatcaggaggag gactcatcgtaa

DBGET integrated database retrieval system