Trichoderma reesei QM6a: TRIREDRAFT_42919 Help Entry TRIREDRAFT_42919  CDS       T02991                                  Symbol rpl40 Name (RefSeq) ubiquitin fusion protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tre  Trichoderma reesei QM6a Pathway tre03010   Ribosome tre04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tre00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TRIREDRAFT_42919 (rpl40)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TRIREDRAFT_42919 (rpl40)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tre03011]     TRIREDRAFT_42919 (rpl40)    04121 Ubiquitin system [BR:tre04121]     TRIREDRAFT_42919 (rpl40) Ribosome [BR:tre03011]  Ribosomal proteins   Eukaryotes    Large subunit     TRIREDRAFT_42919 (rpl40)   Archaea     TRIREDRAFT_42919 (rpl40) Ubiquitin system [BR:tre04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TRIREDRAFT_42919 (rpl40) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Ubiquitin_5 TBK1_ULD DUF2604 UBL_UBAC1 Plexin_RBD Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  18484898 NCBI-ProteinID:  XP_006965948 JGI:  Trire2_42919 UniProt:  G0RKY4 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK ESTLHLVLRLRGGI NT seq 222 nt NT seq  +upstreamnt  +downstreamnt ttcgtgaagaccctgacgggcaagaccatcacccttgaggtcgagtcctccgacacgatc gacaatgtcaagtccaagatccaggacaaggagggcattcccccggaccagcagcgattg atcttcgctggtaagcagctcgaggatggccgaaccctgtccgactacaacatccagaag gagtccactctccacctcgtcctccgtctgcgtggtggtatc

DBGET integrated database retrieval system