Trichoderma reesei QM6a: TRIREDRAFT_43195 Help Entry TRIREDRAFT_43195  CDS       T02991                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism tre  Trichoderma reesei QM6a Pathway tre03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:tre00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     TRIREDRAFT_43195  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tre03036]     TRIREDRAFT_43195    03400 DNA repair and recombination proteins [BR:tre03400]     TRIREDRAFT_43195 Chromosome and associated proteins [BR:tre03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      TRIREDRAFT_43195 DNA repair and recombination proteins [BR:tre03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      TRIREDRAFT_43195 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP Histone HTH_37 Motif Other DBs NCBI-GeneID:  18484912 NCBI-ProteinID:  XP_006961053 JGI:  Trire2_43195 UniProt:  G0R901 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MADTTPENDRERLKSALWYAIGQIVDEESLKRNRNATPQFIGALTEMVWAQIESVAIDLE TFCNHAGRTTVTTDDVLLLARKNPDLHDIMKDFVDGIRAEK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggccgacacgacacctgaaaatgaccgcgaacgtctcaaatcggcactttggtacgcg ataggacaaatcgtggacgaagagtcgctcaagcggaatcgcaatgcgacgccgcagttt atcggggccttgacggagatggtctgggcgcagattgagagcgtagcgattgacctcgag acgttctgcaaccacgccggcagaacgacagtcacaacagacgacgtgctgctgctggcg aggaagaatccggacctgcacgacattatgaaggactttgtcgatgggatcagggcggag aag

DBGET integrated database retrieval system