Trichoderma reesei QM6a: TRIREDRAFT_47055 Help Entry TRIREDRAFT_47055  CDS       T02991                                  Symbol rac1 Name (RefSeq) ras small GTPase RAC1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tre  Trichoderma reesei QM6a Pathway tre04145   Phagosome tre04148   Efferocytosis tre04517   IgSF CAM signaling tre04518   Integrin signaling tre04620   Toll-like receptor signaling pathway tre05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tre00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     TRIREDRAFT_47055 (rac1)    04518 Integrin signaling     TRIREDRAFT_47055 (rac1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TRIREDRAFT_47055 (rac1)    04148 Efferocytosis     TRIREDRAFT_47055 (rac1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     TRIREDRAFT_47055 (rac1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     TRIREDRAFT_47055 (rac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tre04131]     TRIREDRAFT_47055 (rac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tre04147]     TRIREDRAFT_47055 (rac1)    04031 GTP-binding proteins [BR:tre04031]     TRIREDRAFT_47055 (rac1) Membrane trafficking [BR:tre04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     TRIREDRAFT_47055 (rac1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     TRIREDRAFT_47055 (rac1)   Macropinocytosis    Ras GTPases     TRIREDRAFT_47055 (rac1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     TRIREDRAFT_47055 (rac1) Exosome [BR:tre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TRIREDRAFT_47055 (rac1)   Exosomal proteins of other body fluids (saliva and urine)    TRIREDRAFT_47055 (rac1)   Exosomal proteins of colorectal cancer cells    TRIREDRAFT_47055 (rac1)   Exosomal proteins of bladder cancer cells    TRIREDRAFT_47055 (rac1) GTP-binding proteins [BR:tre04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     TRIREDRAFT_47055 (rac1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MAM1 G-alpha Motif Other DBs NCBI-GeneID:  18485126 NCBI-ProteinID:  XP_006964059 JGI:  Trire2_47055 UniProt:  G0RGF4 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MAQAGVQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVIVDGKPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSVVSPPSYDNVAAKWLPEITHHSSGTPIILVGT KIDLRDDPATRAALTKQHMEPVKYENVLNYVKEVNKTNKIIYKYIECSALTQRNLKSVFD EAIRAVLNPTPQASKAKKSKCSIL NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagctggagtgcaatcgctgaagtgtgtcgtgaccggtgacggtgccgtcggc aagacctgtcttctcatctcgtacacgaccaatgctttccccggagagtacatcccgacc gtgtttgacaactactctgctagcgtcattgttgatggcaagccgatcagcctgggtctt tgggacactgcaggccaggaggattatgatagactccggcccttgtcctacccccagacc gacgtgttcctcatctgtttctccgtcgtgagcccgccttcttacgataacgttgccgca aagtggctccccgagatcacccaccactcgtctggaactcccatcatcctcgtcggtacc aagatcgatcttcgcgatgacccggctacccgagccgccctgaccaagcaacacatggag ccggtcaagtacgagaacgtgctcaactacgtcaaggaggtcaacaagaccaacaaaatc atctacaaatacattgagtgttccgccctgactcagcgcaacctcaagagtgtctttgac gaggctattcgtgcggttctcaaccccacccctcaggcttccaaggccaaaaagtccaag tgctcgatcctgtaa

DBGET integrated database retrieval system