Trichoderma reesei QM6a: TRIREDRAFT_73823 Help Entry TRIREDRAFT_73823  CDS       T02991                                  Symbol skp1 Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism tre  Trichoderma reesei QM6a Pathway tre03083   Polycomb repressive complex tre04111   Cell cycle - yeast tre04120   Ubiquitin mediated proteolysis tre04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     TRIREDRAFT_73823 (skp1)    04120 Ubiquitin mediated proteolysis     TRIREDRAFT_73823 (skp1)   09126 Chromosome    03083 Polycomb repressive complex     TRIREDRAFT_73823 (skp1)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     TRIREDRAFT_73823 (skp1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tre04131]     TRIREDRAFT_73823 (skp1)    04121 Ubiquitin system [BR:tre04121]     TRIREDRAFT_73823 (skp1)    03036 Chromosome and associated proteins [BR:tre03036]     TRIREDRAFT_73823 (skp1) Membrane trafficking [BR:tre04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     TRIREDRAFT_73823 (skp1) Ubiquitin system [BR:tre04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      TRIREDRAFT_73823 (skp1)    Cul7 complex      TRIREDRAFT_73823 (skp1) Chromosome and associated proteins [BR:tre03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      TRIREDRAFT_73823 (skp1)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      TRIREDRAFT_73823 (skp1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  18488251 NCBI-ProteinID:  XP_006961632 JGI:  Trire2_73823 UniProt:  G0R7Q3 LinkDB All DBs Position Unknown AA seq 171 aa AA seqDB search MAEAKAASQKIWLVSNDNATMEVDRCVVERSMLLKNMLEDLGGADISPENPIPIPNVNEA VLRKVVEWCEHHRNDPVTAPDDESDARKKTTDIEEWDQKFMQVDQEMLFEIILASNFLDI KPLLDVGCKTVANMIKGKSPEEIRKTFNITNDFSAEEEEQIRRENEWAEDR NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atggcggaagcaaaggctgcgtcccagaagatctggctcgtctccaacgacaatgccacc atggaagttgaccgttgcgtggtcgagcgctccatgctcctgaagaacatgctggaggac ttaggcggcgccgacatcagccccgaaaaccccatccccatccccaacgtcaacgaagcc gtgctgcgaaaggttgtcgagtggtgcgagcaccaccgcaacgaccccgtcactgccccc gatgacgagtccgatgcccgcaagaagacgactgatatcgaggagtgggaccagaagttc atgcaggtggaccaggagatgctctttgagatcatcctggcctccaatttcctggatatc aagccccttctcgatgttggctgcaagaccgtggccaacatgatcaagggcaagtctccc gaggagattcgcaagactttcaacattacaaacgacttctccgccgaggaggaggagcag attcgccgcgagaacgagtgggctgaggaccgataa

DBGET integrated database retrieval system