Thermococcus radiotolerans: A3L10_05310 Help Entry A3L10_05310       CDS       T05177                                  Name (GenBank) 50S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism trl  Thermococcus radiotolerans Pathway trl03010   Ribosome Brite KEGG Orthology (KO) [BR:trl00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A3L10_05310   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A3L10_05310  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:trl03011]     A3L10_05310    04121 Ubiquitin system [BR:trl04121]     A3L10_05310 Ribosome [BR:trl03011]  Ribosomal proteins   Eukaryotes    Large subunit     A3L10_05310   Archaea     A3L10_05310 Ubiquitin system [BR:trl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A3L10_05310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Zn_ribbon_RPAB4 DZR Ribosomal_L40e Toxin_5 DZR_2 Zn_ribbon_10 Zn_ribbon_3 HypA Motif Other DBs NCBI-ProteinID:  ASJ14578 UniProt:  A0A2Z2MXK7 LinkDB All DBs Position complement(988890..989048) Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYICMRCGATNPWKAKKCRKCGYKGLRPKAREPRGGMGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgagattcccagaggctgaggccagaatctttaggaagtacatctgcatgcgctgc ggcgctaccaacccgtggaaggccaagaagtgcaggaagtgcggctacaagggtctccgc ccgaaggcgagagagccgcgcggtggaatgggacgctga

DBGET integrated database retrieval system