Trichomycterus rosablanca: 134303106 Help Entry 134303106         CDS       T09921                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism trn  Trichomycterus rosablanca Pathway trn04010   MAPK signaling pathway trn04068   FoxO signaling pathway trn04081   Hormone signaling trn04114   Oocyte meiosis trn04140   Autophagy - animal trn04150   mTOR signaling pathway trn04810   Regulation of actin cytoskeleton trn04910   Insulin signaling pathway trn04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:trn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134303106 (ins)    04068 FoxO signaling pathway     134303106 (ins)    04150 mTOR signaling pathway     134303106 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     134303106 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134303106 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     134303106 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134303106 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     134303106 (ins)    04914 Progesterone-mediated oocyte maturation     134303106 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:trn04052]     134303106 (ins) Cytokines and neuropeptides [BR:trn04052]  Neuropeptides   Unclassified    134303106 (ins) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  134303106 NCBI-ProteinID:  XP_062844465 LinkDB All DBs Position 26:complement(1684332..1685754) Genome browser AA seq 108 aa AA seqDB search MALWLHAGALLVLLAISTAGGDAAAPQHLCGSHLVDALYLVCGPSGFFYNPKREVDPLLG FLPPKPAQEGEMAEFPYKEHAELMVKRGIVEQCCHKPCSIFDLQNYCN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcattgtggcttcacgctggtgctctcctggtcctgctggccatctccacggcagga ggggacgccgccgcgcctcaacacctgtgcggatctcacctggtcgacgccctctacctg gtctgtggcccgtctggtttcttctacaaccccaagcgagaggtggacccgctactgggt ttccttccccccaaacctgctcaggagggcgagatggccgagttcccgtataaagagcac gccgagctgatggtgaagagaggcatcgtggagcagtgctgccacaaaccgtgcagcatc ttcgacctgcagaactactgcaactga

DBGET integrated database retrieval system