Trichomycterus rosablanca: 134309477 Help Entry 134309477         CDS       T09921                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism trn  Trichomycterus rosablanca Pathway trn04010   MAPK signaling pathway trn04012   ErbB signaling pathway trn04068   FoxO signaling pathway trn04137   Mitophagy - animal trn04140   Autophagy - animal trn04144   Endocytosis trn04150   mTOR signaling pathway trn04210   Apoptosis trn04218   Cellular senescence trn04370   VEGF signaling pathway trn04371   Apelin signaling pathway trn04510   Focal adhesion trn04540   Gap junction trn04625   C-type lectin receptor signaling pathway trn04810   Regulation of actin cytoskeleton trn04910   Insulin signaling pathway trn04912   GnRH signaling pathway trn04916   Melanogenesis trn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:trn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134309477 (hrasa)    04012 ErbB signaling pathway     134309477 (hrasa)    04370 VEGF signaling pathway     134309477 (hrasa)    04371 Apelin signaling pathway     134309477 (hrasa)    04068 FoxO signaling pathway     134309477 (hrasa)    04150 mTOR signaling pathway     134309477 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     134309477 (hrasa)    04140 Autophagy - animal     134309477 (hrasa)    04137 Mitophagy - animal     134309477 (hrasa)   09143 Cell growth and death    04210 Apoptosis     134309477 (hrasa)    04218 Cellular senescence     134309477 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     134309477 (hrasa)    04540 Gap junction     134309477 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134309477 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134309477 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     134309477 (hrasa)    04912 GnRH signaling pathway     134309477 (hrasa)    04916 Melanogenesis     134309477 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134309477 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:trn04131]     134309477 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:trn04147]     134309477 (hrasa)    04031 GTP-binding proteins [BR:trn04031]     134309477 (hrasa) Membrane trafficking [BR:trn04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     134309477 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     134309477 (hrasa) Exosome [BR:trn04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    134309477 (hrasa)   Exosomal proteins of colorectal cancer cells    134309477 (hrasa) GTP-binding proteins [BR:trn04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     134309477 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  134309477 NCBI-ProteinID:  XP_062847042 LinkDB All DBs Position 1:26829006..26855249 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLSPPDESGQD CLNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggtggtggtgggcgctggaggcgtaggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatatgaccctaccatagaggactcatac agaaagcaagtggtgattgatggtgagacatgtctgctggacatcctggacacagcaggt caggaggagtacagtgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtgtttgccataaataacaccaagtcgtttgaagacattcatcagtacagagaacagatc aaacgggtaaaagactcagatgacgtgccaatggtgcttgtgggaaataaatgtgacctc ccagctcgcacagtggatacacggcaagcgcaggatctagcacgcagttacggcatccca tacattgagacctcagccaagaccagacagggagtggaagatgccttctacacactggta cgggagatccgacagcacaagctgaggaaacttagtccccccgacgaaagtggacaggac tgcttgaactgtcgctgtgttgtgtcgtga

DBGET integrated database retrieval system