Trichomycterus rosablanca: 134316593 Help Entry 134316593         CDS       T09921                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism trn  Trichomycterus rosablanca Pathway trn04137   Mitophagy - animal trn04140   Autophagy - animal trn04144   Endocytosis trn04145   Phagosome trn04148   Efferocytosis trn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:trn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     134316593    04145 Phagosome     134316593    04140 Autophagy - animal     134316593    04137 Mitophagy - animal     134316593    04148 Efferocytosis     134316593  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134316593  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:trn04131]     134316593   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:trn04147]     134316593    04031 GTP-binding proteins [BR:trn04031]     134316593 Membrane trafficking [BR:trn04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     134316593 Exosome [BR:trn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134316593   Exosomal proteins of other body fluids (saliva and urine)    134316593   Exosomal proteins of colorectal cancer cells    134316593   Exosomal proteins of bladder cancer cells    134316593 GTP-binding proteins [BR:trn04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     134316593 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 cobW Septin NTPase_1 AAA_16 AAA_7 AAA_22 PduV-EutP AAA_24 SRPRB ATPase_2 AAA_5 NACHT AAA_14 NB-ARC ATP-synt_ab Motif Other DBs NCBI-GeneID:  134316593 NCBI-ProteinID:  XP_062853068 LinkDB All DBs Position 6:42823535..42828526 Genome browser AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDKLVTLQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPTTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLENRQVLTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIASNALKQETEV ELYNEFPEPIKLDRNSSSSSSEQSCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatccaggaagaaagttctgttgaaagtcatcatccttggtgactcaggtgttgga aaaacatcattaatgaaccagtatgttaacaaaaagttcagtaatcagtacaaagctaca ataggagctgactttttgacaaaagaagtgatggttgaagacaaacttgttactctacag atttgggacacagctggacaggagcggtttcagtctctgggagtggcattttatcgtggg gctgactgttgtgtgctggtttttgatgtcactgctcccaccacctttaaaacgctggac tcctggagagatgagtttttgattcaagctagccctcgcgacccagacaacttccctttt gtggtgctcggcaacaaggttgacctggaaaacagacaggtgttgacaaagcgagcacag gcctggtgtcagagtaaaaacaacataccctactttgaaaccagtgcaaaagaggccata aatgtggaacaggcatttcaaactattgccagcaatgccttaaaacaggagaccgaagtg gagctgtataatgagtttcctgagccgattaagttggaccgaaacagcagctcaagctca tcagagcaaagctgcagctgctga

DBGET integrated database retrieval system