Trichomycterus rosablanca: 134316892 Help Entry 134316892         CDS       T09921                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism trn  Trichomycterus rosablanca Pathway trn04081   Hormone signaling trn04144   Endocytosis trn04150   mTOR signaling pathway trn04270   Vascular smooth muscle contraction trn04310   Wnt signaling pathway trn04350   TGF-beta signaling pathway trn04510   Focal adhesion trn04520   Adherens junction trn04530   Tight junction trn04621   NOD-like receptor signaling pathway trn04625   C-type lectin receptor signaling pathway trn04810   Regulation of actin cytoskeleton trn05100   Bacterial invasion of epithelial cells trn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:trn00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     134316892 (rhoca)    04350 TGF-beta signaling pathway     134316892 (rhoca)    04150 mTOR signaling pathway     134316892 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     134316892 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     134316892 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     134316892 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:trn04131]     134316892 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:trn04147]     134316892 (rhoca)    04031 GTP-binding proteins [BR:trn04031]     134316892 (rhoca) Membrane trafficking [BR:trn04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     134316892 (rhoca) Exosome [BR:trn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134316892 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    134316892 (rhoca)   Exosomal proteins of colorectal cancer cells    134316892 (rhoca)   Exosomal proteins of bladder cancer cells    134316892 (rhoca) GTP-binding proteins [BR:trn04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     134316892 (rhoca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  134316892 NCBI-ProteinID:  XP_062853491 LinkDB All DBs Position 6:11560787..11594184 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDVKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGFLECSAKTKDGVREVFEMATRAALQ VRKRKKTSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccataaggaaaaagctggtgatcgtgggagatggagcatgtggaaagacatgt cttcttatagtgtttagtaaagaccagttccctgaggtatacgtccctacagttttcgag aactacattgctgacattgaggtggatgtcaaacaggtggagttggcactgtgggacaca gctgggcaggaagactacgatcgcttaagacccctctcctacccagacacggacgtcatc ctcatgtgcttctcaatcgacagtccagacagtttagagaatattccagaaaagtggaca ccagaggtgaaacacttctgcccgaacgttcccatcatattggtgggcaataagaaggac ctgcgcaatgatgagcacacgcggagagagctggctaagatgaaacaggagcctgtaaaa ccagaggagggtcgggacatggctaaccgtatcagtgcttttggctttctggagtgttca gccaagaccaaggatggcgtaagggaagtgtttgaaatggctaccagggcagcacttcag gtccggaagaggaaaaagacgagtggttgcttgatcttgtga

DBGET integrated database retrieval system