Trichomycterus rosablanca: 134316910 Help Entry 134316910         CDS       T09921                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism trn  Trichomycterus rosablanca Pathway trn03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:trn00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     134316910 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:trn03036]     134316910 (cenps)    03400 DNA repair and recombination proteins [BR:trn03400]     134316910 (cenps) Chromosome and associated proteins [BR:trn03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      134316910 (cenps) DNA repair and recombination proteins [BR:trn03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      134316910 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa TAF ZapG-like Luteo_PO Motif Other DBs NCBI-GeneID:  134316910 NCBI-ProteinID:  XP_062853519 LinkDB All DBs Position 6:complement(13576666..13582129) Genome browser AA seq 132 aa AA seqDB search MDEDEANIQRLKAAVHYTVGKLCESTAAECEKQISRQAIAAIAETTFRQCEIFAKDLEAF AKHAKRHTVTTDDVKLLARRSTALSSYIEQKSEELATNNQELKEKRKKNATKRKSKDMEG NEAEVQTMENDN NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggatgaggatgaagcgaatatacagagactgaaggctgctgtgcactacacagttgga aaactttgtgaaagcacagcggcagagtgcgagaaacagataagtcgacaggctatagct gcaattgctgaaaccacgtttcgacaatgtgaaatatttgccaaagatctagaagctttc gcaaaacatgcgaaacgacacacagtcaccactgatgacgtcaaacttttggcaagaagg agcacagcactgtcaagctacatcgagcaaaaaagtgaagaactggctacaaacaaccag gagctaaaggagaaaagaaagaagaatgccaccaagagaaaaagcaaagacatggagggt aatgaagcagaggtgcagacaatggaaaatgataactaa

DBGET integrated database retrieval system