Trichomycterus rosablanca: 134318282 Help Entry 134318282         CDS       T09921                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism trn  Trichomycterus rosablanca Pathway trn04010   MAPK signaling pathway trn04012   ErbB signaling pathway trn04068   FoxO signaling pathway trn04137   Mitophagy - animal trn04140   Autophagy - animal trn04150   mTOR signaling pathway trn04210   Apoptosis trn04218   Cellular senescence trn04370   VEGF signaling pathway trn04371   Apelin signaling pathway trn04540   Gap junction trn04625   C-type lectin receptor signaling pathway trn04810   Regulation of actin cytoskeleton trn04910   Insulin signaling pathway trn04912   GnRH signaling pathway trn04916   Melanogenesis Brite KEGG Orthology (KO) [BR:trn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134318282 (nras)    04012 ErbB signaling pathway     134318282 (nras)    04370 VEGF signaling pathway     134318282 (nras)    04371 Apelin signaling pathway     134318282 (nras)    04068 FoxO signaling pathway     134318282 (nras)    04150 mTOR signaling pathway     134318282 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134318282 (nras)    04137 Mitophagy - animal     134318282 (nras)   09143 Cell growth and death    04210 Apoptosis     134318282 (nras)    04218 Cellular senescence     134318282 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     134318282 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134318282 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134318282 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     134318282 (nras)    04912 GnRH signaling pathway     134318282 (nras)    04916 Melanogenesis     134318282 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:trn04131]     134318282 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:trn04147]     134318282 (nras)    04031 GTP-binding proteins [BR:trn04031]     134318282 (nras) Membrane trafficking [BR:trn04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     134318282 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     134318282 (nras) Exosome [BR:trn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134318282 (nras)   Exosomal proteins of other body fluids (saliva and urine)    134318282 (nras)   Exosomal proteins of breast cancer cells    134318282 (nras)   Exosomal proteins of colorectal cancer cells    134318282 (nras) GTP-binding proteins [BR:trn04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     134318282 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  134318282 NCBI-ProteinID:  XP_062855190 LinkDB All DBs Position 7:21039219..21056751 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGESCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL AKTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtaggagcaggtggtgttgggaagagtgcactcacc atacagctcatccagaatcacttcgtagatgaatatgaccccaccatagaggactcctac agaaagcaggttgtaatcgatggtgaatcatgtctgctggacatcctggacacagcagga caagaagagtacagtgccatgagggaccagtatatgaggaccggagagggctttctttgt gtgtttgccatcaataacaccaaatcttttgctgatgtgcatttgtaccgggagcagatc aagcgagtaaaagactctgatgacgtgcccatggttctggttggaaacaaatgtgatttg gccaaaaccgttgacaccaagcaggctcaggagctagccaggagctatggcatcgaattt gttgaaacatcagccaagaccagacagggggtcgaggatgctttttacaccctcgtccgg gagattcgtcattaccgcatgaaaaagctcaacagcagggaggacaggaaacagggctgc ctcggagtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system