Trichomycterus rosablanca: 134323928 Help Entry 134323928         CDS       T09921                                  Symbol dbi Name (RefSeq) acyl-CoA-binding protein   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism trn  Trichomycterus rosablanca Pathway trn03320   PPAR signaling pathway Brite KEGG Orthology (KO) [BR:trn00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     134323928 (dbi)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:trn04052]     134323928 (dbi) Cytokines and neuropeptides [BR:trn04052]  Neuropeptides   Unclassified    134323928 (dbi) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACBP FERM_M JmjN Motif Other DBs NCBI-GeneID:  134323928 NCBI-ProteinID:  XP_062861609 LinkDB All DBs Position 12:5761999..5769575 Genome browser AA seq 87 aa AA seqDB search MSEEAFQKAAEEVKQLKAKPTDAEMLEIYSLYKQSTVGDVNTARPGMLDFTGKAKWDGWD SKKGMSKEDAMKAYISKVEELKKKYGI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctgaggaggcatttcagaaggcagcggaagaggtgaagcagctgaaagcgaagcca actgatgctgagatgctggagatctacagtctgtataaacaatccacagtgggagacgtc aacaccgctcgacctggcatgctagacttcactggaaaagctaagtgggatggctgggat tcgaagaaaggtatgagcaaggaagacgcaatgaaggcttacatcagcaaagtggaggag ctgaaaaaaaaatatggaatttaa

DBGET integrated database retrieval system