Trichomycterus rosablanca: 134329069 Help Entry 134329069         CDS       T09921                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism trn  Trichomycterus rosablanca Brite KEGG Orthology (KO) [BR:trn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:trn03036]     134329069   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:trn04147]     134329069 Chromosome and associated proteins [BR:trn03036]  Eukaryotic type   Nucleosome assembly factors    Histones     134329069 Exosome [BR:trn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134329069 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  134329069 NCBI-ProteinID:  XP_062866384 LinkDB All DBs Position 15:complement(25494872..25495291) Genome browser AA seq 94 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDRRISRRATVPGL NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcaagaaccaagcagaccgctcgtaaatccaccggtggtaaagcgccgaggaagcag ctcgccactaaggctgcccgcaagagcgccccggctactggcggtgtgaagaaacctcac cgttacaggccaggtaccgtggctctgcgtgaaatccgccgttatcagaagtccactgag ctgctcatccgcaagctgcccttccagcgcctggttagagagatcgctcaggactttaag accgatcggcggatttcacgcagagccacggtacctggcctgtaa

DBGET integrated database retrieval system