Trichomycterus rosablanca: 134329073 Help Entry 134329073         CDS       T09921                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism trn  Trichomycterus rosablanca Brite KEGG Orthology (KO) [BR:trn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:trn03036]     134329073   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:trn04147]     134329073 Chromosome and associated proteins [BR:trn03036]  Eukaryotic type   Nucleosome assembly factors    Histones     134329073 Exosome [BR:trn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134329073 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  134329073 NCBI-ProteinID:  XP_062866389 LinkDB All DBs Position 15:complement(23321503..23390197) Genome browser AA seq 81 aa AA seqDB search MKQVHPDTGIFSKAMGIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPG ELAKHAVSEGTKAVTKYTSSK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaaacaggtccaccctgataccgggatcttctccaaggctatgggcatcatgaactcc ttcgtcaacgacattttcgagcgtatcgctggtgagtcctctcgtctggctcactacaac aagcgctccaccatcacctccagggagatccagaccgccgtgcgcctgctgcttcccggt gagctggccaagcacgccgtgtccgagggtaccaaggccgtcaccaagtacaccagctcc aagtaa

DBGET integrated database retrieval system